Antibodies

Jump to Filters
View as table Download
ASAH2 Rabbit Polyclonal Antibody
TA349659

USD 380.00

2 Weeks

Rabbit Polyclonal Anti-ASAH2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ASAH2
PPAP2A (PLPP1) Rabbit Polyclonal Antibody
TA322830

USD 380.00

4 Weeks

Anti-PPAP2A Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 40-53 amino acids of human phosphatidic acid phosphatase type 2A
Phytoceramidase (ACER3) Rabbit Polyclonal Antibody
TA315581

USD 380.00

4 Weeks

Rabbit polyclonal anti-PHCA antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PHCA.
PPAP2A (PLPP1) Rabbit Polyclonal Antibody
TA322829

USD 380.00

In Stock

Anti-PPAP2A Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 40-53 amino acids of human phosphatidic acid phosphatase type 2A
Sphingomyelin Synthase 1 (SGMS1) Rabbit Polyclonal Antibody
AP05279PU-N

USD 580.00

5 Days

Sphingomyelin Synthase 1 (SGMS1) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide derived from the Human Sphingomyelin Synthase 1 protein
UGT8 (Center) Rabbit Polyclonal Antibody
AP54457PU-N

USD 580.00

2 Weeks

UGT8 (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 373-401 amino acids from the Central region of human UGT8
PPAP2A (PLPP1) Rabbit Polyclonal Antibody
TA346363

USD 485.00

5 Days

Rabbit Polyclonal Anti-PPAP2A Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PPAP2A antibody: synthetic peptide directed towards the middle region of human PPAP2A. Synthetic peptide located within the following region: DPDWSKINCSDGYIEYYICRGNAERVKEGRLSFYSGHSSFSMYCMLFVAL
DEGS1 Rabbit Polyclonal Antibody
AP05308PU-N

USD 580.00

5 Days

DEGS1 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide derived from the Human DEGS1 protein