Anti-FOXO1 (Phospho-Ser256) Rabbit Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of serine 256 (A-A-S(p)-M-D) derived from Human FKHR. |
| Modifications | Phospho-specific |
Rabbit Polyclonal PPARGC1A Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PPARGC1A antibody was raised against a 19 amino acid peptide near the carboxy terminus of human PPARGC1A. The immunogen is located within the last 50 amino acids of PPARGC1A. |
Rabbit Polyclonal SQSTM1 Antibody
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | SQSTM1 antibody was raised against a 14 amino acid synthetic peptide from near the carboxy terminus of human SQSTM1. The immunogen is located within the last 50 amino acids of SQSTM1. |
Rabbit Polyclonal antibody to LDB1 (LIM domain binding 1)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse (Predicted: Rhesus Monkey) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 86 and 411 of LDB1 (Uniprot ID#Q86U70) |
Rabbit Polyclonal XBP-1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | XBP-1 antibody was raised against an 18 amino acid synthetic peptide from near the amino terminus of human XBP-1. The immunogen is located within amino acids 40 - 90 of XBP-1. |
Rabbit polyclonal KLF4 Antibody (N-term C74)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This KLF4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 69-101 amino acids from the N-terminal region of human KLF4. |
Rabbit Polyclonal antibody to Rad54 (alpha thalassemia/mental retardation syndrome X-linked (RAD54 homolog, S. cerevisiae))
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse (Predicted: Chimpanzee) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 2161 and 2443 of Rad54 (Uniprot ID#P46100) |
Rabbit Polyclonal Anti-EED Antibody
| Applications | IF, WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EED antibody: synthetic peptide directed towards the N terminal of human EED. Synthetic peptide located within the following region: GDENDDAVSIESGTNTERPDTPTNTPNAPGRKSWGKGKWKSKKCKYSFKC |
Rabbit polyclonal ENOA Antibody (N-term)
| Applications | FC, IF, WB |
| Reactivities | Human, Mouse (Predicted: Bovine, Monkey) |
| Conjugation | Unconjugated |
| Immunogen | This ENOA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 33-60 amino acids from the N-terminal region of human ENOA. |
Rabbit Polyclonal IRF7 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | IRF7 antibody was raised against a peptide corresponding to 14 amino acids near the carboxy terminus of human IRF7. The immunogen is located within amino acids 420 - 470 of IRF7. |
Germany
Japan
United Kingdom
China
