CDC27 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CDC27 |
CDC27 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CDC27 |
Rabbit Polyclonal Anti-CDC27 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CDC27 |
CDC27 mouse monoclonal antibody, clone 5C12, Ascites
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-APC3 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | APC3 antibody was raised against a 19 amino acid synthetic peptide near the carboxy terminus of human APC3. |
Rabbit polyclonal anti-H-NUC antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human H-NUC. |
CDC27 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide, corresponding to amino acids 360-410 of Human Cdc27. |
CDC27 Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 551-830 of human CDC27 (NP_001107563.1). |
Modifications | Unmodified |
Rabbit polyclonal CDC27 phospho T244 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding aa 239-249 of Human CDC27. |
Rabbit Polyclonal Anti-CDC27 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-CDC27 Antibody: synthetic peptide directed towards the middle region of human CDC27. Synthetic peptide located within the following region: KLKMKFPPKIPNRKTKSKTNKGGITQPNINDSLEITKLDSSIISEGKIST |
Rabbit Polyclonal Anti-CDC27 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CDC27 antibody is: synthetic peptide directed towards the C-terminal region of Human CDC27. Synthetic peptide located within the following region: SYIDSAVISPDTVPLGTGTSILSKQVQNKPKTGRSLLGGPAALSPLTPSF |
CDC27 Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human CDC27 |
CDC27 pSer427 rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, WB |
Reactivities | Canine, Chimpanzee, Chicken, Human, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding aa 422-430 of Human CDC27 |
CDC27 (422-430) rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, WB |
Reactivities | Canine, Chimpanzee, Chicken, Human, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding amino acids 422-430 of Human cdc27 |