Rabbit Polyclonal MUC-1 Antibody
| Applications | FC, ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Porcine |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptides corresponding to MUC1(mucin 1, cell surface associated) The peptide sequence was selected from the C terminal region between aa 1200-1250 of human MUC1 (NP_001037855). Peptide sequence GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL. |
TAC1 mouse monoclonal antibody, clone SP-DE4-21, Purified
| Applications | ELISA, IF, IHC |
| Reactivities | Guinea Pig, Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal anti-CALR Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Dog, Chicken, Drosophila, Fish, Monkey, Porcine, Rabbit, Sheep, Hamster, Guinea Pig |
| Conjugation | Unconjugated |
| Immunogen | Human calreticulin synthetic peptide with a cysteine residue added and the peptide conjugated to KLH |
TAC1 mouse monoclonal antibody, clone SP-DE4-21, Purified
| Applications | ELISA, IF, IHC |
| Reactivities | Guinea Pig, Human, Mouse, Rat |
| Conjugation | Unconjugated |
VIP guinea pig polyclonal antibody, Serum
| Applications | IF, IHC |
| Reactivities | Feline, Guinea Pig, Human, Porcine, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic Human VIP (Peninsula, #7161). |
CD8A mouse monoclonal antibody, clone CT6, Supernatant
| Applications | FC, IHC |
| Reactivities | Guinea Pig |
| Conjugation | Unconjugated |
Rabbit Polyclonal Antibody against VEGFA
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Dog, Horse, Cow, Rat, Chicken, Guinea Pig |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal region of the human VEGFA protein sequence (between residues 150-250). [Swiss-Prot# P15692] |
Neuropeptide Y (NPY) rabbit polyclonal antibody
| Applications | IF, IHC |
| Reactivities | Chicken, Feline, Guinea Pig, Human, Rat, Zebrafish |
| Conjugation | Unconjugated |
WNT7A Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Bovine, Chimpanzee, Chicken, Dog, Xenopus, Gorilla, Human, Monkey, Mouse, Pig, Rabbit, Rat, Gibbon, Hamster, Horse, Orang-Utan, Guinea Pig |
| Conjugation | Unconjugated |
| Immunogen | WNT7A antibody was raised against synthetic 12 amino acid peptide from internal region of human WNT7A. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Bat, Horse, Rabbit, Pig, Guinea pig, Turkey, Zebra finch, Chicken, Platypus, Lizard, Xenopus (100%); Seabass (92%); Stickleback, Pufferfish, Zebrafish (83%). |
Goat Anti-Decorin Antibody
| Applications | WB |
| Reactivities | Human, Cow, Pig, Guinea Pig |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KISRVDAASLKGLNN, from the internal region of the protein sequence according to NP_001911.1; NP_598011.1; NP_598012.1;. |
Rabbit Polyclonal Anti-WNT2 Antibody (Internal)
| Applications | IHC |
| Reactivities | Human (Predicted: Mouse, Rat, Bat, Bovine, Dog, Hamster, Pig, Rabbit, Sheep, Chicken, Guinea Pig) |
| Conjugation | Unconjugated |
| Immunogen | WNT2 / IRP antibody was raised against synthetic 15 amino acid peptide from internal region of human WNT2. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Baboon, Monkey, Marmoset (100%); Galago, Mouse, Rat, Ferret, Sheep, Hamster, Elephant, Panda, Dog, Bovine, Cat, Bat, Rabbit, Pig, Opossum, Guinea pig, Turkey, Chicken, Armadillo, Platypus (93%); Horse (87%). |
Elastin (ELN) mouse monoclonal antibody, clone IL-4, Purified
| Applications | IHC, IP |
| Reactivities | Bovine, Canine, Guinea Pig, Human |
| Conjugation | Unconjugated |
ProDynorphin (PDYN) (1-13) rabbit polyclonal antibody, Serum
| Applications | IHC, R |
| Reactivities | Guinea Pig, Hamster, Human, Monkey, Porcine, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide, YGGFLRRQFKVVT, corresponding to full-length porcine dynorphin B (1-13), conjugated to thyroglobulin. |
CD8A mouse monoclonal antibody, clone CT6, FITC
| Applications | FC |
| Reactivities | Guinea Pig |
| Conjugation | FITC |
Germany
Japan
United Kingdom
China
