Primary Antibodies

View as table Download

CD82 mouse monoclonal antibody, clone B-L2, Azide Free

Applications FC, IHC
Reactivities Human
Conjugation Unconjugated

Rabbit anti-CD82 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CD82

CD82 mouse monoclonal antibody, clone B-L2, Purified

Applications FC, IHC
Reactivities Human
Conjugation Unconjugated

CD82 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence at the C-terminal of human CD82

Rabbit Polyclonal Anti-CD82 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CD82 antibody is: synthetic peptide directed towards the middle region of CD82. Synthetic peptide located within the following region: ELIRDYNSSREDSLQDAWDYVQAQVKCCGWVSFYNWTDNAELMNRPEVTY

CD82 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated