CD82 mouse monoclonal antibody, clone B-L2, Azide Free
Applications | FC, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
CD82 mouse monoclonal antibody, clone B-L2, Azide Free
Applications | FC, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit anti-CD82 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CD82 |
CD82 mouse monoclonal antibody, clone B-L2, Purified
Applications | FC, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
CD82 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a sequence at the C-terminal of human CD82 |
Rabbit Polyclonal Anti-CD82 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CD82 antibody is: synthetic peptide directed towards the middle region of CD82. Synthetic peptide located within the following region: ELIRDYNSSREDSLQDAWDYVQAQVKCCGWVSFYNWTDNAELMNRPEVTY |
CD82 Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |