CD82 Rabbit Polyclonal Antibody

CAT#: TA343300

Rabbit Polyclonal Anti-CD82 Antibody

Product Images

WB Suggested Anti-CD82 Antibody; Titration: 1.0 ug/ml; Positive Control: Fetal Brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CD82 antibody is: synthetic peptide directed towards the middle region of CD82. Synthetic peptide located within the following region: ELIRDYNSSREDSLQDAWDYVQAQVKCCGWVSFYNWTDNAELMNRPEVTY
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 27 kDa
• Gene Name: CD82 molecule
• Database Link:
  NP_001020015
  Entrez Gene 3732 Human
  UniProt ID P27701
• Background: This metastasis suppressor gene product is a membrane glycoprotein that is a member of the transmembrane 4 superfamily. Expression of this gene has been shown to be downregulated in tumor progression of human cancers and can be activated by p53 through a consensus binding sequence in the promoter. Its expression and that of p53 are strongly correlated, and the loss of expression of these two proteins is associated with poor survival for prostate cancer patients. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
• Synonyms: 4F9; C33; GR15; IA4; KAI1; R2; SAR2; ST6; TSPAN27
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: p53 signaling pathway