Primary Antibodies

View as table Download

GTF2H3 mouse monoclonal antibody,clone OTI4B5

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

GTF2H3 mouse monoclonal antibody,clone OTI6E12

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GTF2H3 mouse monoclonal antibody,clone OTI4B5

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GTF2H3 mouse monoclonal antibody,clone OTI6E12

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal anti-GTF2H3 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GTF2H3 antibody: synthetic peptide directed towards the N terminal of human GTF2H3. Synthetic peptide located within the following region: VIASHIQESRFLYPGKNGRLGDFFGDPGNPPEFNPSGSKDGKYELLTSAN

Rabbit Polyclonal anti-GTF2H3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GTF2H3 antibody is: synthetic peptide directed towards the middle region of Human GTF2H3. Synthetic peptide located within the following region: KGQHTETLLAGSLAKALCYIHRMNKEVKDNQEMKSRILVIKAAEDSALQY