GTF2H3 Rabbit Polyclonal Antibody

CAT#: TA329285

Rabbit Polyclonal anti-GTF2H3 antibody

Product Images

WB Suggested Anti-GTF2H3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:2500; Positive Control: Jurkat cell lysateGTF2H3 is supported by BioGPS gene expression data to be expressed in Jurkat

• 

  Human Muscle

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GTF2H3 antibody: synthetic peptide directed towards the N terminal of human GTF2H3. Synthetic peptide located within the following region: VIASHIQESRFLYPGKNGRLGDFFGDPGNPPEFNPSGSKDGKYELLTSAN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 34 kDa
• Gene Name: general transcription factor IIH subunit 3
• Database Link:
  NP_001507
  Entrez Gene 2967 Human
  UniProt ID Q13889
• Background: GTranscription Factor Antibodies2H3 interacts with HIV-1 Tat as a component of the HIV-1 transcription pre-initiation complex, but is released from the elongation complex which includes P-TEFb. It synergizes with HIV-1 Tat to induce transcription elongation from the HIV-1 LTR promoter.
• Synonyms: BTF2; P34; TFB4; TFIIH
• Note: Immunogen sequence homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Bovine: 92%; Guinea pig: 92%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors
• Protein Pathways: Basal transcription factors, Nucleotide excision repair