Primary Antibodies

View as table Download

Iba1 (149-161) goat polyclonal antibody, Purified from goat serum by ammonium sulphate precipitation followed by antigen affinity chromatography using the immunizing peptide.

Applications ELISA, IHC, WB
Reactivities Hamster, Human, Monkey, Mouse, Porcine, Rat, Bovine, Equine, Goat, Rabbit, Pig
Conjugation Unconjugated
Immunogen Peptide with sequence C-TGPPAKKAISELP, from the C-Terminus of protein sequence according to NP_116573.1NP_001614.3.

Rabbit Polyclonal MUC-1 Antibody

Applications FC, ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Porcine
Conjugation Unconjugated
Immunogen Synthetic peptides corresponding to MUC1(mucin 1, cell surface associated) The peptide sequence was selected from the C terminal region between aa 1200-1250 of human MUC1 (NP_001037855). Peptide sequence GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL.

Horse Chorionic Gonadotropin (CG) rabbit polyclonal antibody, Serum

Applications R, WB
Reactivities Equine
Conjugation Unconjugated
Immunogen Purified Horse Chorionic Gonadotropin

Dopamine beta Hydroxylase (DBH) rabbit polyclonal antibody

Applications IF, IHC, WB
Reactivities Bovine, Equine, Human, Mouse, Rat
Conjugation Unconjugated

Annexin A1 (ANXA1) (324-337) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Bovine, Canine, Human, Mouse, Porcine, Rat, Bat, Equine, Guinea Pig, Hamster, Monkey, Rabbit
Conjugation Unconjugated
Immunogen Peptide from the C Terminus of the protein sequence according to NP_000691.1

RPL22 (106-119) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC
Reactivities Human, Mouse, Rat, Bovine, Canine, Chicken, Equine, Monkey, Porcine, Rabbit, Xenopus
Conjugation Unconjugated
Immunogen Synthetic peptide from C-terminus of human RPL22

Rabbit Polyclonal CXCR7/RDC-1 Antibody

Applications FC, ICC/IF, IHC, Simple Western, WB
Reactivities Human, Mouse, Rat, Bovine, Equine, Primate
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding amino acids 106-129 of human CXCR7/RDC1 was used as the immunogen, GenBank NP_064707.1.

TLR7 (900-950) rabbit polyclonal antibody, Purified

Applications FC, IHC, WB
Reactivities Bovine, Canine, Equine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide from a portion of amino acids 900-950 of Human TLR7

XPR1 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC
Reactivities Bovine, Bat, Canine, Chicken, Equine, Hamster, Human, Monkey, Mouse, Porcine, Rabbit, Rat
Conjugation Unconjugated
Immunogen Synthetic 16 amino acid peptide from the N-terminal cytoplasmic domain of human XPR1.

WNT3 (315-329) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Canine, Human, Mouse, Rat, Bovine, Bat, Chicken, Equine, Monkey, Porcine, Xenopus, Zebrafish
Conjugation Unconjugated
Immunogen Synthetic peptide from an internal region of human WNT3

PPAR delta (PPARD) (430-441) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human, Bovine, Bat, Canine, Chicken, Equine, Hamster, Monkey, Mouse, Porcine, Rabbit, Rat, Zebrafish
Conjugation Unconjugated
Immunogen Synthetic peptide from the C-terminus of human PPARD

SNX16 (2-14) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Bovine, Canine, Human, Mouse, Rat, Equine, Hamster, Monkey, Rabbit
Conjugation Unconjugated
Immunogen Synthetic peptide from the N-terminus of human SNX16 (NP_071416.2; NP_690049.1; NP_690050.1)

Rabbit Polyclonal NFkB p65 NLS Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Bovine, Equine, Primate
Conjugation Unconjugated
Immunogen A portion of the NFkB p65 NLS nuclear localization signal (NLS) (amino acids DTDDRHRIEEKRKRKT) was used as the immunogen for this antibody.

PCB (PC) (886-899) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Bovine, Canine, Human, Mouse, Porcine, Rat, Bat, Equine, Hamster, Monkey, Rabbit
Conjugation Unconjugated
Immunogen Synthetic peptide from an Internal region of Human PC

FOXO3 (661-673) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human, Bovine, Bat, Canine, Chicken, Equine, Hamster, Monkey, Mouse, Porcine, Rabbit, Rat, Sheep
Conjugation Unconjugated
Immunogen Synthetic peptide from C Terminus of human FKHRL1 / FOXO3A