Rabbit polyclonal RELA Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide conjugated to KLH derived from within residues 100 - 170 of Human RELA. |
Rabbit polyclonal RELA Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide conjugated to KLH derived from within residues 100 - 170 of Human RELA. |
Rabbit Polyclonal Anti-CD81 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CD81 antibody is: synthetic peptide directed towards the C-terminal region of Human CD81. Synthetic peptide located within the following region: LKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFE |
Rabbit polyclonal RELA Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide conjugated to KLH derived from within residues 100 - 170 of Human RELA. |
Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody
Applications | Dot, WB |
Reactivities | Human (Predicted: Mouse, Rat, Drosophila) |
Conjugation | Unconjugated |
Immunogen | This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2. |
Modifications | Phospho-specific |
Phospho-RAC1-S71 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A phospho specific peptide corresponding to residues surrounding S71 of human RAC1 |
Rabbit anti-NF-kB p105/p50 (Phospho-Ser337) polyclonal antibody (Phospho-specific)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanNF-κB p105/p50 around the phosphorylation site of serine 337 (R-K-SP-D-L). |
Modifications | Phospho-specific |
Rabbit polyclonal Akt (Ser473) antibody(Phospho-specific)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Akt |
Modifications | Phospho-specific |
Rabbit Polyclonal antibody to PPP3CB (protein phosphatase 3, catalytic subunit, beta isozyme)
Applications | IHC, WB |
Reactivities | Human, Mouse (Predicted: Chicken, Rabbit, Rat, Xenopus, Bovine, X. tropicalis) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 228 of PPP3CB (Uniprot ID#P16298) |
Rabbit Polyclonal NF- kappaB p105/p50 (Ser932) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human NF- kappaB p105/p50 around the phosphorylation site of Serine 932 |
Modifications | Phospho-specific |
Rabbit Polyclonal antibody to RAC1 (ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1))
Applications | IHC, WB |
Reactivities | Human, Mouse (Predicted: Chicken, Dog, Pig, Rat, Xenopus, Bovine, X. tropicalis) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 196 of RAC1 (Uniprot ID#P63000 isoform B) |
Rabbit Polyclonal SYK (Tyr348) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human SYK around the phosphorylation site of Tyrosine 348 |
Modifications | Phospho-specific |
Rabbit Polyclonal CD81 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | CD81 antibody was raised against a 20 amino acid peptide near the amino terminus of human CD81. |
Anti-RAC2 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 50-192 amino acids of human ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2) |
Anti-LILRB3 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide peptide corresponding to a region derived from 560-572 amino acids of human leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 3 |
Rabbit polyclonal SOS2 Antibody (N-term)
Applications | FC, WB |
Reactivities | Human (Predicted: Mouse) |
Conjugation | Unconjugated |
Immunogen | This SOS2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 188-215 amino acids from the N-terminal region of human SOS2. |