Rabbit polyclonal FAM50A Antibody (C-term)
| Applications | WB |
| Reactivities | Human (Predicted: Mouse, Zebrafish, Xenopus) |
| Conjugation | Unconjugated |
| Immunogen | This FAM50A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 311-339 amino acids from the C-terminal region of human FAM50A. |
Rabbit Polyclonal Anti-PTBP1 Antibody
| Applications | WB |
| Reactivities | Human, Rat, Dog, Zebrafish, Bovine, Pig, Rabbit, Mouse, Guinea Pig, Horse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PTBP1 antibody: synthetic peptide directed towards the middle region of human PTBP1. Synthetic peptide located within the following region: KGFKFFQKDRKMALIQMGSVEEAVQALIDLHNHDLGENHHLRVSFSKSTI |
Goat Polyclonal Anti-MNSOD (aa119-130) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat (Expected from sequence similarity: Dog, Pig, Cow, Zebrafish) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MNSOD (aa119-130) Antibody: Peptide with sequence C-EAIKRDFGSFDK, from the internal region of the protein sequence according to NP_000627.2; NP_001019637.1. |
Rabbit Polyclonal Anti-Alpha-tubulin Antibody (biotin)
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Rabbit, Chicken, Zebrafish |
| Conjugation | Biotin |
| Immunogen | Biotin-Alpha-tubulin antibody was raised against an 18 amino acid peptide near the carboxy terminus of human alpha-tubulin |
Mouse Monoclonal Anti-beta-Actin Antibody [10B7] (biotin)
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Rabbit, Chicken, Zebrafish, Drosophila |
| Conjugation | Biotin |
Anti-RBPMS Antibody
| Applications | FC, ICC, IHC, WB |
| Reactivities | Feline, Guinea Pig, Pig, Human, Mouse, Rabbit, Rat, Tree Shrew, Whale, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to amino acid residues from the N-terminal region of rat RBPMS, conjugated to keyhole limpet hemocyanin (KLH). |
Goat Polyclonal Anti-MGP Antibody
| Applications | WB |
| Reactivities | Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 26 aa to the C-terminus of zebra fish MGP produced in E. coli. |
Rabbit Polyclonal Anti-RAB4B Antibody
| Reactivities | Human, Mouse, Pig, Dog, Horse, Zebrafish, Brugia malayi |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RAB4B antibody is: synthetic peptide directed towards the middle region of Human RAB4B. Synthetic peptide located within the following region: SPNIVVILCGNKKDLDPEREVTFLEASRFAQENELMFLETSALTGENVEE |
p38 (MAPK14) pThr180/pTyr182 rabbit polyclonal antibody, Purified
| Applications | WB |
| Reactivities | Bovine, Canine, Chicken, Human, Monkey, Mouse, Rat, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | Synthetic phosphopeptide corresponding to an amino acid sequence within p38 MAPK which includes phosphorylated Thr180 and Tyr182. |
GSK3 beta (GSK3B) pSer9 rabbit polyclonal antibody, Purified
| Applications | WB |
| Reactivities | Bovine, Canine, Chicken, Human, Monkey, Mouse, Rat, Xenopus, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | Phosphopeptide corresponding to amino acid sequence surrounding phoshorylated seine 9 of rat GSK3 beta. |
MEK5 (MAP2K5) pSer311/pThr315 rabbit polyclonal antibody, Purified
| Applications | WB |
| Reactivities | Bovine, Canine, Chicken, Human, Monkey, Mouse, Rat, Xenopus, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | Synthetic phosphopeptide corresponding to an amino acid sequence within MEK5 , which includes phoshorylated Ser311 and Thr315. |
GAP43 pSer41 rabbit polyclonal antibody, Purified
| Applications | WB |
| Reactivities | Bovine, Canine, Chicken, Human, Monkey, Mouse, Rat, Xenopus, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | Synthetic phosphopeptide corresponding to an amino acid sequence within GAP-43 which includes phosphorylated Ser41. |
GJA1 pSer368 rabbit polyclonal antibody, Purified
| Applications | WB |
| Reactivities | Bovine, Canine, Chicken, Guinea Pig, Human, Mouse, Rat, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | Synthetic phosphopeptide corresponding to an amino acid sequence within connexin43 which includes phosphorylated Ser368 |
Ionotropic Glutamate receptor 2 (GRIA2) rabbit polyclonal antibody, Purified
| Applications | WB |
| Reactivities | Chicken, Human, Monkey, Mouse, Rat, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | Keyhole limpet haemocyanin conjugated synthetic peptide corresponding to an amino acid sequence within rat GluR2. |
Germany
Japan
United Kingdom
China