Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-CES2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CES2 antibody: synthetic peptide directed towards the C terminal of human CES2. Synthetic peptide located within the following region: HWPLFDQEEQYLQLNLQPAVGRALKAHRLQFWKKALPQKIQELEEPEERH

Anti-CES2 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 355-369 amino acids of human carboxylesterase 2

Rabbit anti-CES2 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide of human CES2

Rabbit polyclonal anti-CES2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human CES2.

Rabbit Polyclonal anti-CES2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CES2 antibody: synthetic peptide directed towards the middle region of human CES2. Synthetic peptide located within the following region: QHQPSWLKNIRPPHMKADHVKFTEEEEQLSRKMMKYWANFARNGNPNGEG