CES2 Rabbit Polyclonal Antibody
Frequently bought together (3)
Recombinant protein of human carboxylesterase 2 (intestine, liver) (CES2), transcript variant 1, 20 µg
USD 867.00
Transient overexpression lysate of carboxylesterase 2 (intestine, liver) (CES2), transcript variant 1
USD 436.00
Other products for "CES2"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-CES2 antibody: synthetic peptide directed towards the middle region of human CES2. Synthetic peptide located within the following region: QHQPSWLKNIRPPHMKADHVKFTEEEEQLSRKMMKYWANFARNGNPNGEG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 67 kDa |
Gene Name | carboxylesterase 2 |
Database Link | |
Background | This gene encodes a member of the carboxylesterase large family. The family members are responsible for the hydrolysis or transesterification of various xenobiotics, such as cocaine and heroin, and endogenous substrates with ester, thioester, or amide bonds. They may participate in fatty acyl and cholesterol ester metabolism, and may play a role in the blood-brain barrier system. The protein encoded by this gene is the major intestinal enzyme and functions in intestine drug clearance. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Oct 2010] |
Synonyms | CE-2; CES2A1; iCE; PCE-2 |
Note | Immunogen sequence homology: Human: 100% |
Reference Data | |
Protein Families | Druggable Genome |
Protein Pathways | Drug metabolism - other enzymes |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.