Rabbit Polyclonal Antibody against HMGB1 - Oligodendrocyte Marker
| Applications | ELISA, FC, ICC/IF, IHC, Simple Western, WB |
| Reactivities | Human, Mouse, Dog, Bovine, Hamster, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal portion of the human HMGB1 protein sequence (between residues 100-200). [UniProt #P09429] |
Rabbit polyclonal PCNA Antibody (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human (Predicted: Mouse, Rat, Bovine, Chicken, Hamster, Monkey) |
| Conjugation | Unconjugated |
| Immunogen | This PCNA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 89-117 amino acids from the Central region of human PCNA. |
Rabbit Polyclonal Antibody against TPX2
| Applications | FC, ICC/IF, IP, Simple Western, WB |
| Reactivities | Human, Mouse, Bovine, Goat, Hamster, Sheep |
| Conjugation | Unconjugated |
| Immunogen | Produced by immunizing rabbits with a recombinant segment of the C-terminal domain of the human protein |
Rabbit polyclonal anti-HSPD1(HSP60) antibody(Center), Loading control
| Applications | IF, WB |
| Reactivities | Human (Predicted: Mouse, Rat, Bovine, Chicken, Hamster) |
| Conjugation | Unconjugated |
| Immunogen | This HSPD1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 187-215 amino acids from the Central region of human HSPD1. |
Rabbit polyclonal STIP1 Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human (Predicted: Mouse, Rat, Bovine, Hamster) |
| Conjugation | Unconjugated |
| Immunogen | This STIP1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 269-297 amino acids from the Central region of human STIP1. |
Rabbit polyclonal HSPD1 Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse (Predicted: Rat, Bovine, Chicken, Hamster) |
| Conjugation | Unconjugated |
| Immunogen | This HSPD1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 396-423 amino acids from the C-terminal region of human HSPD1. |
Rabbit polyclonal HMGA1 Antibody (C-term)
| Applications | FC, IF, WB |
| Reactivities | Human (Predicted: Mouse, Rat, Hamster) |
| Conjugation | Unconjugated |
| Immunogen | This HMGA1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 64-93 amino acids from the C-terminal region of human HMGA1. |
Rabbit polyclonal STIP1 Antibody (C-term)
| Applications | FC, WB |
| Reactivities | Human, Mouse (Predicted: Rat, Bovine, Hamster, Monkey) |
| Conjugation | Unconjugated |
| Immunogen | This STIP1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 461-488 amino acids from the C-terminal region of human STIP1. |
Rabbit polyclonal Phospho-p53(S20) Antibody
| Applications | IHC, WB |
| Reactivities | Human (Predicted: Hamster, Pig, Monkey, Rabbit) |
| Conjugation | Unconjugated |
| Immunogen | This p53 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding S20 of human p53. |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-ATIC Antibody
| Applications | WB |
| Reactivities | Human, Hamster |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATIC antibody: synthetic peptide directed towards the N terminal of human ATIC. Synthetic peptide located within the following region: YVVVSTEMQSSESKDTSLETRRQLALKAFTHTAQYDEAISDYFRKQYSKG |
Rabbit polyclonal Cyclin B1 phospho S126 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Dog, Hamster, Rat, Chimpanzee |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 120-131 of Human Cyclin B1 protein. |
Germany
Japan
United Kingdom
China
