GTF2H3 mouse monoclonal antibody,clone OTI4B5
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
GTF2H3 mouse monoclonal antibody,clone OTI4B5
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
GTF2H3 mouse monoclonal antibody,clone OTI6E12
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GTF2H3 mouse monoclonal antibody,clone OTI4B5
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GTF2H3 mouse monoclonal antibody,clone OTI6E12
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
GTF2H3 mouse monoclonal antibody,clone OTI4B5, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
GTF2H3 mouse monoclonal antibody,clone OTI4B5, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
USD 509.00
2 Weeks
GTF2H3 mouse monoclonal antibody,clone OTI6E12, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
GTF2H3 mouse monoclonal antibody,clone OTI6E12, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Rabbit Polyclonal anti-GTF2H3 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GTF2H3 antibody: synthetic peptide directed towards the N terminal of human GTF2H3. Synthetic peptide located within the following region: VIASHIQESRFLYPGKNGRLGDFFGDPGNPPEFNPSGSKDGKYELLTSAN |
Rabbit Polyclonal anti-GTF2H3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-GTF2H3 antibody is: synthetic peptide directed towards the middle region of Human GTF2H3. Synthetic peptide located within the following region: KGQHTETLLAGSLAKALCYIHRMNKEVKDNQEMKSRILVIKAAEDSALQY |
GTF2H3 mouse monoclonal antibody,clone OTI4B5
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
GTF2H3 mouse monoclonal antibody,clone OTI6E12
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |