Primary Antibodies

View as table Download

Rabbit polyclonal anti-EFNA5 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human EFNA5.

Ephrin A5 (EFNA5) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-EFNA5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EFNA5 antibody is: synthetic peptide directed towards the N-terminal region of Human EFNA5. Synthetic peptide located within the following region: EDSVPEDKTERYVLYMVNFDGYSACDHTSKGFKRWECNRPHSPNGPLKFS

Rabbit Polyclonal Anti-EFNA5 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-EFNA5 antibody is: synthetic peptide directed towards the middle region of Human EFNA5. Synthetic peptide located within the following region: FDGYSACDHTSKGFKRWECNRPHSPNGPLKFSEKFQLFTPFSLGFEFRPG

Rabbit Polyclonal Anti-EFNA5 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-EFNA5 Antibody: A synthesized peptide derived from human EFNA5