Mouse Monoclonal alpha Tubulin Antibody (DM1A) - Microtubule Marker
Applications | CyTOF-ready, FC, ICC/IF, IHC, IP, Simple Western, WB |
Reactivities | Bovine, Chicken, Guinea Pig, Human, Mouse, Porcine, Rat, Xenopus |
Conjugation | Unconjugated |
Mouse Monoclonal alpha Tubulin Antibody (DM1A) - Microtubule Marker
Applications | CyTOF-ready, FC, ICC/IF, IHC, IP, Simple Western, WB |
Reactivities | Bovine, Chicken, Guinea Pig, Human, Mouse, Porcine, Rat, Xenopus |
Conjugation | Unconjugated |
Collagen I (COL1A1) rabbit polyclonal antibody, Biotin
Applications | ELISA, FC, IHC, IP, WB |
Reactivities | Bovine, Human, Mammalian, Mouse, Rat |
Conjugation | Biotin |
Immunogen | Collagen Type I from Human and Bovine placenta. |
Mouse Monoclonal RPE65 Antibody (401.8B11.3D9)
Applications | CyTOF-ready, FC, ICC/IF, IHC, IP, Simple Western, WB |
Reactivities | Bovine, Human, Mouse, Porcine |
Conjugation | Unconjugated |
Rabbit Polyclonal Antibody against HMGB1 - Oligodendrocyte Marker
Applications | ELISA, FC, ICC/IF, IHC, Simple Western, WB |
Reactivities | Human, Mouse, Dog, Bovine, Hamster, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal portion of the human HMGB1 protein sequence (between residues 100-200). [UniProt #P09429] |
Rabbit Polyclonal Calnexin Antibody
Applications | FC, ICC/IF, IHC, IP, Simple Western, WB |
Reactivities | Human, Mouse, Rat, Bovine, Chicken, Avian, Drosophila |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal region of the canine Calnexin protein (within residues 25-100). [Swiss-Prot P24643] |
Rabbit Polyclonal LRRK2 Antibody
Applications | FC, ICC/IF, IHC, IP, WB |
Reactivities | Bovine, Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A C-terminal synthetic peptide made to the human LRRK2 protein sequence (between residues 2500-2527). |
Mouse Monoclonal IGF-II R/Mannose 6 Phosphate Receptor (Cation independent) Antibody (2G11)
Applications | CyTOF-ready, ELISA, FC, ICC/IF, IHC, IP, WB |
Reactivities | Human, Rat, Bovine, Primate |
Conjugation | Unconjugated |
Rabbit Polyclonal Calreticulin Antibody
Applications | Block/Neutralize, Dot, Electron Microscopy, FC, ICC/IF, IHC, IP, Protein Array, Simple Western, WB |
Reactivities | Human, Mouse, Rat, Bovine, Hamster, Primate |
Conjugation | Unconjugated |
Immunogen | A fusion protein to mouse Calreticulin [UniProt# P14211] |
Rabbit Polyclonal PKM2 Antibody
Applications | FC, ICC/IF, IHC, Immunoblotting, IP, Simple Western, WB |
Reactivities | Bovine, Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to the internal region of human PKM2 protein (within residues 350-450). [Swiss-Prot# P14618] |
Rabbit Polyclonal Perilipin Antibody
Applications | FC, ICC/IF, IHC, WB |
Reactivities | Bovine, Human, Mouse, Porcine, Rat, Sheep |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to a region between residues 450-522 (C-terminus) of the human perilipin protein. [Swiss-Prot# O60240] |
Rabbit Polyclonal MUC-1 Antibody
Applications | FC, ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Porcine |
Conjugation | Unconjugated |
Immunogen | Synthetic peptides corresponding to MUC1(mucin 1, cell surface associated) The peptide sequence was selected from the C terminal region between aa 1200-1250 of human MUC1 (NP_001037855). Peptide sequence GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL. |
Rabbit Polyclonal SR-BI Antibody
Applications | Block/Neutralize, FC, ICC/IF, IHC, Immunoblotting, IP, Simple Western, WB |
Reactivities | Human, Mouse, Rat, Bovine, Hamster, Mustelid |
Conjugation | Unconjugated |
Immunogen | A C-terminal peptide containing residues from mouse SR-BI (within residues 450-509). [UniProt# Q61009] |
Rabbit polyclonal ENOA Antibody (N-term)
Applications | FC, IF, WB |
Reactivities | Human, Mouse (Predicted: Bovine, Monkey) |
Conjugation | Unconjugated |
Immunogen | This ENOA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 33-60 amino acids from the N-terminal region of human ENOA. |
Mouse Monoclonal Antibody against CUG-BP1 (3B1)
Applications | FC, ICC/IF, IHC, IP, Simple Western, WB |
Reactivities | Human, Mouse, Rat, Bovine, Porcine, Rabbit |
Conjugation | Unconjugated |
Mouse Monoclonal LDL Receptor Antibody (C7)
Applications | Electron Microscopy, ELISA, FC, ICC/IF, IHC, IP, WB |
Reactivities | Bovine, Human |
Conjugation | Unconjugated |