Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit polyclonal Aurora-C Antibody (N-term G11)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This Aurora-C antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human Aurora-C. |
Rabbit polyclonal AurB/C (Ab-202/175) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human AurB/C around the phosphorylation site of threonine 202/175 (C-G-TP-L-D). |
Rabbit polyclonal Aurora-C Antibody (N-term M1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This Aurora-C antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human Aurora-C. |
Rabbit Polyclonal Anti-AURKC Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-AURKC Antibody: synthetic peptide directed towards the middle region of human AURKC. Synthetic peptide located within the following region: TYDEKVDLWCIGVLCYELLVGYPPFESASHSETYRRILKVDVRFPLSMPL |
Active filters
Target Symbol
- AURORA C
Antibody Hosts
- Rabbit
Families
- Protein Kinase