Primary Antibodies

Jump to Filters
View as table Download
Tyrosinase (TYR) Rabbit Polyclonal Antibody
TA323680

USD 380.00

In Stock

Anti-TYR Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 19-319 amino acids of human tyrosinase
Dopamine beta Hydroxylase (DBH) Rabbit Polyclonal Antibody
TA349869

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-DBH Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human DBH
Monoamine Oxidase B (MAOB) Rabbit Polyclonal Antibody
TA327079

USD 365.00

2 Weeks

Rabbit anti-MAOB Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human MAOB
TRP1 (TYRP1) Rabbit Polyclonal Antibody
TA335249

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-TYRP1 Antibody

Applications IHC, WB
Reactivities Mouse, Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TYRP1 antibody: synthetic peptide directed towards the middle region of human TYRP1. Synthetic peptide located within the following region: NDPIFVLLHTFTDAVFDEWLRRYNADISTFPLENAPIGHNRQYNMVPFWP
TRP2 (DCT) Rabbit Polyclonal Antibody
TA311708

USD 380.00

2 Weeks

Rabbit polyclonal anti-DCT (dopachrome tautomerase) antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human DCT.
COMT Rabbit Polyclonal Antibody
TA335255

USD 539.00

5 Days

Rabbit Polyclonal Anti-COMT Antibody

Applications WB
Reactivities Human, Rat, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-COMT antibody: synthetic peptide directed towards the middle region of human COMT. Synthetic peptide located within the following region: PDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDH
Monoamine Oxidase B (MAOB) Rabbit Polyclonal Antibody
TA332354

USD 539.00

5 Days

Rabbit Polyclonal Anti-MAOB Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-MAOB Antibody: synthetic peptide directed towards the N terminal of human MAOB. Synthetic peptide located within the following region: RDRVGGRTYTLRNQKVKYVDLGGSYVGPTQNRILRLAKELGLETYKVNEV
Tyrosinase (TYR) Rabbit Polyclonal Antibody
TA323679

USD 380.00

In Stock

Anti-TYR Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 19-319 amino acids of human tyrosinase
Tyrosinase (TYR) Rabbit Polyclonal Antibody
TA327028

USD 365.00

3 Weeks

TYR Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human TYR
Dopamine beta Hydroxylase (DBH) Rabbit Polyclonal Antibody
TA327402

USD 365.00

3 Weeks

DBH Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human DBH
VAP1 (AOC3) Rabbit Polyclonal Antibody
TA332495

USD 365.00

3 Weeks

Rabbit anti-AOC3 Polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human AOC3
TRP1 (TYRP1) Rabbit Polyclonal Antibody
TA335247

USD 485.00

5 Days

Rabbit Polyclonal Anti-TYRP1 Antibody

Applications WB
Reactivities Mouse, Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TYRP1 antibody: synthetic peptide directed towards the N terminal of human TYRP1. Synthetic peptide located within the following region: AKRTTHPLFVIATRRSEEILGPDGNTPQFENISIYNYFVWTHYYSVKKTF