TRP1 (TYRP1) Rabbit Polyclonal Antibody

CAT#: TA335249

Rabbit Polyclonal Anti-TYRP1 Antibody


USD 539.00

2 Weeks*

Size
    • 100 ul

Product Images

Frequently bought together (3)
Transient overexpression lysate of tyrosinase-related protein 1 (TYRP1)
    • 100 ug

USD 436.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00


Recombinant protein of human tyrosinase-related protein 1 (TYRP1), 20 µg
    • 20 ug

USD 867.00

Other products for "TRP1"

Specifications

Product Data
Applications IHC, WB
Recommended Dilution WB, IHC
Reactivities Mouse, Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-TYRP1 antibody: synthetic peptide directed towards the middle region of human TYRP1. Synthetic peptide located within the following region: NDPIFVLLHTFTDAVFDEWLRRYNADISTFPLENAPIGHNRQYNMVPFWP
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 61 kDa
Gene Name tyrosinase related protein 1
Background TYRP1 catalyses the oxidation of 5,6-dihydroxyindole-2-carboxylic acid (DHICA) into indole-5,6-quinone-2-carboxylic acid. It may regulate or influence the type of melanin synthesized.
Synonyms b-PROTEIN; CAS2; CATB; GP75; OCA3; TRP; TRP1; TYRP
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 93%; Zebrafish: 86%
Reference Data
Protein Families Druggable Genome, Transmembrane
Protein Pathways Melanogenesis, Metabolic pathways, Tyrosine metabolism

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.