Sftpb (NM_147779) Mouse Recombinant Protein

CAT#: TP526883

Purified recombinant protein of Mouse surfactant associated protein B (Sftpb), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR226883 representing NM_147779
  Red=Cloning site Green=Tags(s)
  
  MAKSHLLQWLLLLPTLCCPGAAITSASSLECAQGPQFWCQSLEHAVQCRALGHCLQEVWGHAGANDLCQE
  CEDIVHLLTKMTKEDAFQEAIRKFLEQECDILPLKLLVPRCRQVLDVYLPLVIDYFQSQINPKAICNHVG
  LCPRGQAKPEQNPGMPDAVPNPLLDKLVLPVLPGALLARPGPHTQDFSEQQLPIPLPFCWLCRTLIKRVQ
  AVIPKGVLAVAVSQVCHVVPLVVGGICQCLAERYTVLLLDALLGRVVPQLVCGLVLRCSTEDAMGPALPA
  VEPLIEEWPLQDTECHFCKSVINQAWNTSEQAMPQAMHQACLRFWLDRQKCEQFVEQHMPQLLALVPRSQ
  DAHITCQALGVCEAPASPLQCFQTPHL
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 57.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_680088
• Locus ID: 20388
• UniProt ID: P50405
• Cytogenetics: 6 32.27 cM
• Refseq Size: 1887
• Refseq ORF: 1131
• Synonyms: AI562151; SF-B; Sftp-3; Sftp3; SP-B
• Summary: Pulmonary surfactant-associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. SP-B increases the collapse pressure of palmitic acid to nearly 70 millinewtons per meter.[UniProtKB/Swiss-Prot Function]