Bhlha15 (NM_010800) Mouse Recombinant Protein

CAT#: TP524224

Purified recombinant protein of Mouse basic helix-loop-helix family, member a15 (Bhlha15), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR224224 representing NM_010800
  Red=Cloning site Green=Tags(s)
  
  MKTKNRPPRRRTPMQDTEATPGEQTPDRPQSGSGGSELTKGLRSRTARASGGRGEVSRRRQGSGGRRENS
  VQRRLESNERERQRMHKLNNAFQALREVIPHVRADKKLSKIETLTLAKNYIKSLTATILTMSSSRLPGLE
  APGPAPGPKLYQHYHHQQQQQQQQQQVAGAMLGVTEDQPQGHLQRYSTQIHSFREGS
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 22.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_034930
• Locus ID: 17341
• UniProt ID: Q9QYC3
• Cytogenetics: 5 G2
• Refseq Size: 3494
• Refseq ORF: 591
• Synonyms: 1810009C13Rik; Bhlhb8; MIST-1; Mist1
• Summary: Plays a role in controlling the transcriptional activity of MyoD, ensuring that expanding myoblast populations remain undifferentiated (PubMed:17612490). Repression may occur through muscle-specific E-box occupancy by homodimers. May also negatively regulate bHLH-mediated transcription through an N-terminal repressor domain. Serves as a key regulator of acinar cell function, stability, and identity. Also required for normal organelle localization in exocrine cells and for mitochondrial calcium ion transport. May function as a unique regulator of gene expression in several different embryonic and postnatal cell lineages. Binds to the E-box consensus sequence 5'-CANNTG-3'.[UniProtKB/Swiss-Prot Function]