Rgs10 (NM_026418) Mouse Recombinant Protein

CAT#: TP520775

Purified recombinant protein of Mouse regulator of G-protein signalling 10 (Rgs10), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR220775 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MFTRAVSRLSRKRPPSDIHDGDGSSSSGHQSLKSTAKWASSLENLLEDPEGVQRFREFLKKEFSEENVLF
  WLACEDFKKTEDRKQMQEKAKEIYMTFLSNKASSQVNVEGQSRLTEKILEEPHPLMFQKLQDQIFNLMKY
  DSYSRFLKSDLFLKPKRTEEEEEEPPDAQTAAKRASRIYNT
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 21.2 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_080694
• Locus ID: 67865
• UniProt ID: Q9CQE5, Q32MD7
• Cytogenetics: 7 F3
• Refseq Size: 875
• Refseq ORF: 546
• Synonyms: 2310010N19Rik
• Summary: Regulates G protein-coupled receptor signaling cascades, including signaling downstream of the muscarinic acetylcholine receptor CHRM2. Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits, thereby driving them into their inactive GDP-bound form. Modulates the activity of potassium channels that are activated in response to CHRM2 signaling. Activity on GNAZ is inhibited by palmitoylation of the G-protein.[UniProtKB/Swiss-Prot Function]