Nucks1 (NM_001145804) Mouse Recombinant Protein

CAT#: TP518534

Purified recombinant protein of Mouse nuclear casein kinase and cyclin-dependent kinase substrate 1 (Nucks1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR218534 representing NM_001145804
  Red=Cloning site Green=Tags(s)
  
  MSRPVRNRKVVDYSQFQESDDADEDYGRDSGPPAKKIRSSPREAKNKRRSGKNSQEDSEDSEEKDVKTKK
  DDSHSAEDSEDEKDDHKNVRQQRQAASKAASKQREMLLEDVGSEEEPEEDDEAPFQENSGSDEDFLMEDD
  DDSDYGSSKKKNKKMVKKSKPERKEKKMPKPRLKATVTPSPVKGKAKVGRPTASKKSKEKTPSPKEEDEE
  AESPPEKKSGDEGSEDEASSGED
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 26.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001139276
• Locus ID: 98415
• UniProt ID: Q80XU3
• Cytogenetics: 1 E4
• Refseq Size: 6093
• Refseq ORF: 699
• Synonyms: 2700010L10Rik; 8430423A01Rik; AI647518; C78391; Nucks
• Summary: Chromatin-associated protein involved in DNA repair by promoting homologous recombination (HR). Binds double-stranded DNA (dsDNA) and secondary DNA structures, such as D-loop structures, but with less affinity than RAD51AP1.[UniProtKB/Swiss-Prot Function]