Cnot3 (NM_146176) Mouse Recombinant Protein

CAT#: TP510463

Purified recombinant protein of Mouse CCR4-NOT transcription complex, subunit 3 (Cnot3), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR210463 representing NM_146176
  Red=Cloning site Green=Tags(s)
  
  MADKRKLQGEIDRCLKKVSEGVEQFEDIWQKLHNAANANQKEKYEADLKKEIKKLQRLRDQIKTWVASNE
  IKDKRQLIENRKLIETQMERFKVVERETKTKAYSKEGLGLAQKVDPAQKEKEEVGQWLTNTIDTLNMQVD
  QFESEVESLSVQTRKKKGDKDKQDRIEGLKRHIEKHRYHVRMLETILRMLDNDSILVDAIRKIKDDVEYY
  VDSSQDPDFEENEFLYDDLDLEDIPQALVATSPPSHSHMEDEIFNQSSSTPTSTTSSSPIPPSPANCTTE
  NSEDDKKRGRSTDSEVSQSPAKNGSKPVHSNQHPQSPAVPPTYPSGPPPTTSALSSTPGNNGASTPAAPT
  SALGPKASPAPSHNSGTPAPYAQAVAPPNASGPSNAQPRPPSAQPSGGSGGGSGGSSSNSNSGTGGGAGK
  QNGATSYSSVVADSPAEVTLSSSGGSSASSQALGPTSGPHNPAPSTSKESSTAAPSGAGNVASGSGNNSG
  GPSLLVPLPVNPPSSPTPSFSEAKAAGTLLNGPPQFSTTPEIKAPEPLSSLKSMAERAAISSGIEDPVPT
  LHLTDRDIILSSTSAPPTSSQPPLQLSEVNIPLSLGVCPLGPVSLTKEQLYQQAMEEAAWHHMPHPSDSE
  RIRQYLPRNPCPTPPYHHQMPPPHSDTVEFYQRLSTETLFFIFYYLEGTKAQYLAAKALKKQSWRFHTKY
  MMWFQRHEEPKTITDEFEQGTYIYFDYEKWGQRKKEGFTFEYRYLEDRDLQ
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 82.4 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_666288
• Locus ID: 232791
• UniProt ID: Q8K0V4
• Cytogenetics: 7 A1
• Refseq Size: 2923
• Refseq ORF: 2253
• Synonyms: A930039N10Rik
• Summary: Component of the CCR4-NOT complex which is one of the major cellular mRNA deadenylases and is linked to various cellular processes including bulk mRNA degradation, miRNA-mediated repression, translational repression during translational initiation and general transcription regulation. Additional complex functions may be a consequence of its influence on mRNA expression. May be involved in metabolic regulation; may be involved in recruitment of the CCR4-NOT complex to deadenylation target mRNAs involved in energy metabolism. Involved in mitotic progression and regulation of the spindle assembly checkpoint by regulating the stability of MAD1L1 mRNA. Can repress transcription and may link the CCR4-NOT complex to transcriptional regulation; the repressive function may involve histone deacetylases. Involved in the maintenance of embryonic stem (ES) cell identity; prevents their differentiation towards extraembryonic trophectoderm lineages.[UniProtKB/Swiss-Prot Function]