Ppp2r5b (NM_198168) Mouse Recombinant Protein

CAT#: TP507982

Purified recombinant protein of Mouse protein phosphatase 2, regulatory subunit B', beta (Ppp2r5b), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR207982 protein sequence
  Red=Cloning site Green=Tags(s)
  
  METKLPPASTPTSPSSPGLSPVPPPDKVDGFSRRSLRRARPRRSHSSSQFRYQSNQQELTPLPLLKDVPA
  SELHELLSRKLAQCGVMFDFLDCVADLKGKEVKRAALNELVECVGCTRGVLIEPVYPDIIRMISVNIFRT
  LPPSENPEFDPEEDEPNLEPSWPHLQLVYEFFLRFLESPDFQPSVAKRYVDQKFVLMLLELFDSEDPRER
  EYLKTILHRVYGKFLGLRAYIRKQCNHIFLRFIYELEHFNGVAELLEILGSIINGFALPLKTEHKQFLVR
  VLIPLHSVKSLSVFHAQLAYCVVQFLEKDATLTEHVIRGLLKYWPKTCTQKEVMFLGEMEEILDVIEPSQ
  FVKIQEPLFKQVARCVSSPHFQVAERALYFWNNEYILSLIEDNCHTVLPAVFGTLYQVSKEHWNQTIVSL
  IYNVLKTFMEMNGKLFDELTASYKLEKQQEQQKAQERQELWRGLEELRLRRLQGTQGAKEAPVPRPTPQV
  AASGGQS
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 57.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• Locus ID: 225849
• UniProt ID: Q6PD28
• Cytogenetics: 19 A
• Refseq Size: 2708
• Refseq ORF: 1494
• Synonyms: B'beta; BC026670
• Summary: As the regulatory component of the serine/threonine-protein phosphatase 2A (PP2A) holoenzyme, modulates substrate specificity, subcellular localization, and responsiveness to phosphorylation. The phosphorylated form mediates the interaction between PP2A and AKT1, leading to AKT1 dephosphorylation.[UniProtKB/Swiss-Prot Function]