Ero1a (NM_015774) Mouse Recombinant Protein

CAT#: TP507416

Purified recombinant protein of Mouse ERO1-like (S. cerevisiae) (Ero1l), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug


USD 988.00

4 Weeks*

Size
    • 20 ug

Product Images

Frequently bought together (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

USD 471.00

Other products for "Ero1a"

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR207416 protein sequence
Red=Cloning site Green=Tags(s)

MGRAWGLLVGLLGVVWLLRLGHGEERRPETAAQRCFCQVSGYLDDCTCDVETIDKFNNYRLFPRLQKLLE
SDYFRYYKVNLKKPCPFWNDINQCGRRDCAVKPCHSDEVPDGIKSASYKYSEEANRIEEGEQAERLGAVD
ESLSEETQKAVLQWTKHDDSSDSFCEIDDIQSPDAEYVDLLLNPERYTGYKGPDAWRIWSVIYEENCFKP
QTIQRPLASGRGKSKENTFYNWLEGLCVEKRAFYRLISGLHASINVHLSARYLLQDTWLEKKWGHNVTEF
QQRFDGILTEGEGPRRLRNLYFLYLIELRALSKVLPFFERPDFQLFTGNKVQDAENKALLLEILHEIKSF
PLHFDENSFFAGDKNEAHKLKEDFRLHFRNISRIMDCVGCFKCRLWGKLQTQGLGTALKILFSEKLIANM
PESGPSYEFQLTRQEIVSLFNAFGRISTSVRELENFRHLLQNVH

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 54 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_056589
Locus ID 50527
UniProt ID Q8R180, Q4FK57
Cytogenetics 14 C1
Refseq Size 4435
Refseq ORF 1395
Synonyms Er; ERO1-L; Ero1l
Summary This gene encodes a member of the endoplasmic reticulum oxidoreductin family. The encoded protein is localized to the endoplasmic reticulum and promotes the formation of disulfide bonds by oxidizing protein disulfide isomerase. This gene may play a role in endoplasmic reticulum stress-induced apoptosis and the cellular response to hypoxia. [provided by RefSeq, Feb 2011]

Documents

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.