Mecr (NM_025297) Mouse Recombinant Protein

CAT#: TP505775

Purified recombinant protein of Mouse mitochondrial trans-2-enoyl-CoA reductase (Mecr), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR205775 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLVSQRVTGARARAPQLAGLLEAWYRHGRTTSSYSALSEPSRVRALVYGNHGDPAKVVQLKNLELTAVEG
  SDVHVRMLAAPINPSDINMIQGNYGLLPKLPAVGGNEGVGQVIAVGSSVSALKPGDWVIPANAGLGTWRT
  EAVFSEEALIGIPKDIPLQSAATLGVNPCTAYRMLVDFEQLQPGDSVIQNASNSGVGQAVIQIASALRLK
  TINVVRDRPDIKKLTDRLKDLGADYVLTEEELRMPETKTIFKDLPLPRLALNCVGGKSSTELLRHLAPGG
  TMVTYGGMAKQPVTASVSLLIFKDLKLRGFWLSQWKKNHSPDEFKELILTLCNLIRQGRLTAPSCSEVPL
  QGYQQALEASMKPFVSSKQILTM
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 40.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_079573
• Locus ID: 26922
• UniProt ID: Q9DCS3
• Cytogenetics: 4 D2.3
• Refseq Size: 1337
• Refseq ORF: 1122
• Synonyms: AI195831; NRBF-1; Nrbf1
• Summary: Catalyzes the NADPH-dependent reduction of trans-2-enoyl thioesters in mitochondrial fatty acid synthesis (fatty acid synthesis type II). Fatty acid chain elongation in mitochondria uses acyl carrier protein (ACP) as an acyl group carrier, but the enzyme accepts both ACP and CoA thioesters as substrates in vitro. Has a preference for short and medium chain substrates, including trans-2-hexenoyl-CoA (C6), trans-2-decenoyl-CoA (C10), and trans-2-hexadecenoyl-CoA (C16).[UniProtKB/Swiss-Prot Function]