Zfyve27 (NM_177319) Mouse Recombinant Protein
CAT#: TP505235
Purified recombinant protein of Mouse zinc finger, FYVE domain containing 27 (Zfyve27), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Product Images
Frequently bought together (1)
Other products for "Zfyve27"
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR205235 representing NM_177319
Red=Cloning site Green=Tags(s) MQTSDRDLSGPEASPSGMPEVLSECPPAPTKSAAFDLFNLVLSYKRLEIYLEPLKDAGDGVRYLLRWQMP LCSLLTCLGLNILFLTLNEGAWYSMGALMISVPALLGYLQEVCRGQLPESELMRRKYHSIRQEDLQRVRL SRVHLSRPEAVAEVKSFLIQLEAFLARLCYTCESAYRVLHWENPVVSSQFYGALLGMVCMLYLLPLCWVL ALLNSTLFLGNGDFFRVVCEYRACLQRRMNPRQEECACESSALQGAGGRGLLDSSPAPTPTEDLTPGSVE EAEEAEPDEEFKDAIEETHLVVLEDEEGTPCPAEDELTLQDNGFLSKNEVLRSKVSRLTERLRKRYPTNN FGNCAGCAATFSVLKKRRSCSNCGNSFCSRCCSFKVPRSSMGATAPEAQRETVCVCASCNQTLSK myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 46.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_796293 |
Locus ID | 319740 |
UniProt ID | Q3TXX3 |
Cytogenetics | 19 C3 |
Refseq Size | 5636 |
Refseq ORF | 1245 |
Synonyms | 2210011N02Rik; 9530077C24Rik; AI426636; AI593546; AI835681 |
Summary | Key regulator of RAB11-dependent vesicular trafficking during neurite extension through polarized membrane transport (By similarity). Promotes axonal elongation and contributes to the establishment of neuronal cell polarity (PubMed:24251978). Involved in nerve growth factor-induced neurite formation in VAPA-dependent manner. Contributes to both the formation and stabilization of the tubular ER network. Involved in ER morphogenesis by regulating the sheet-to-tubule balance and possibly the density of tubule interconnections (By similarity). Acts as an adapter protein that facilitates the interaction of KIF5A with VAPA, VAPB, SURF4, RAB11A, RAB11B and RTN3 and the ZFYVE27-KIF5A complex contributes to the transport of these proteins in neurons. Can induce formation of neurite-like membrane protrusions in non-neuronal cells in a KIF5A/B-dependent manner (PubMed:21976701).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.