Ackr1 (NM_010045) Mouse Recombinant Protein
CAT#: TP504947
Purified recombinant protein of Mouse atypical chemokine receptor 1 (Duffy blood group) (Ackr1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Product Images
Frequently bought together (1)
Other products for "Ackr1"
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR204947 protein sequence
Red=Cloning site Green=Tags(s) MGNCLYPVETLSLDKNGTQFTFDSWNYSFEDNYSYELSSDYSLTPAAPCYSCNLLDRSSLPFFMLTSVLG MLASGSILFAILRPFFHWQICPSWPILAELAVGSALFSIAVPILAPGLHSAHSTALCNLGYWVWYTSAFA QALLIGCYACLNPRLNIGQLRGFTLGLSVGLWGAAALSGLPVALASDVYNGFCTFPSSRDMEALKYTHYA ICFTIFTVLPLTLLAAKGLKIALSKGPGPWVSVLWIWFIFWWPHGMVLIFDALVRSKTVLLYTCQSQKIL DAMLNVTEALSMLHCVATPLLLALFCHQTTRRSLSSLSLPTRQASQMDALAGKS myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 36.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_034175 |
Locus ID | 13349 |
UniProt ID | Q9QUI6, A0A0R4J0J4 |
Cytogenetics | 1 80.33 cM |
Refseq Size | 1158 |
Refseq ORF | 1005 |
Synonyms | AA162249; CCBP1; CD234; Darc; Dfy; ESTM35; FY; GPD |
Summary | Atypical chemokine receptor that controls chemokine levels and localization via high-affinity chemokine binding that is uncoupled from classic ligand-driven signal transduction cascades, resulting instead in chemokine sequestration, degradation, or transcytosis. Also known as interceptor (internalizing receptor) or chemokine-scavenging receptor or chemokine decoy receptor. Has a promiscuous chemokine-binding profile, interacting with inflammatory chemokines of both the CXC and the CC subfamilies but not with homeostatic chemokines. Acts as a receptor for chemokines including CCL2, CCL5, CCL7, CCL11, CCL13, CCL14, CCL17, CXCL5, CXCL6, IL8/CXCL8, CXCL11, GRO, RANTES, MCP-1 and TARC. May regulate chemokine bioavailability and, consequently, leukocyte recruitment through two distinct mechanisms: when expressed in endothelial cells, it sustains the abluminal to luminal transcytosis of tissue-derived chemokines and their subsequent presentation to circulating leukocytes; when expressed in erythrocytes, serves as blood reservoir of cognate chemokines but also as a chemokine sink, buffering potential surges in plasma chemokine levels (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.