Hsd17b6 (NM_013786) Mouse Recombinant Protein

CAT#: TP504561

Purified recombinant protein of Mouse hydroxysteroid (17-beta) dehydrogenase 6 (Hsd17b6), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR204561 representing NM_013786
  Red=Cloning site Green=Tags(s)
  
  MWFYLVTLVGLYHLLRWYRERQVVSHLQDKYVFITGCDSGFGNLLARQLDRRGMRVLAACLTEKGAEELR
  NKTSDRLETVILDVTKTESIVAATQWVKERVGDRGLWGLVNNAGVLQPFAYIEWYRPEDYMPIFQVNLIG
  LTQVTISMLFLVKKARGRIVNVSSALGRVALFGGFYSCSKYGVEAFSDVLRHEVQDFGVKVSIIEPGSFK
  TEMTDAELTIERTKKVWEAAPEHIKESYGQQFFDDFCSTTKRELMKCSRNLSLVTDCMEHALTSTHPRTR
  YSAGWDAKFFFIPLSYLPASLVDYLLAISRGKPAQAA
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 36.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_038814
• Locus ID: 27400
• UniProt ID: Q9R092
• Cytogenetics: 10 D3
• Refseq Size: 1479
• Refseq ORF: 951
• Synonyms: 17betaHSD9; Hsd17b9; Rdh8
• Summary: NAD-dependent oxidoreductase with broad substrate specificity that shows both oxidative and reductive activity (in vitro). Has 17-beta-hydroxysteroid dehydrogenase activity towards various steroids (in vitro). Converts 5-alpha-androstan-3-alpha,17-beta-diol to androsterone and estradiol to estrone (in vitro). Has 3-alpha-hydroxysteroid dehydrogenase activity towards androsterone (in vitro). Has retinol dehydrogenase activity towards all-trans-retinol (in vitro).[UniProtKB/Swiss-Prot Function]