Uck1 (NM_011675) Mouse Recombinant Protein

CAT#: TP503731

Purified recombinant protein of Mouse uridine-cytidine kinase 1 (Uck1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR203731 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MASAGGGGSESAAPEADRPQPRPFLIGVSGGTASGKSTVCEKIMELLGQNEVDRRQRKLVILSQDCFYKV
  LTAEQKAKALKGQYNFDHPDAFDNDLMHKTLKNIVEGKTVEVPTYDFVTHSRLPETTVVYPADVVLFEGI
  LVFYTQEIRDMFHLRLFVDTDSDVRLSRRVLRDVQRGRDLEQILTQYTAFVKPAFEEFCLPTKKYADVII
  PRGVDNMVAINLIVQHIQDILNGDLCKRHRGGPNGRNHKRTFPEPGDHPGVLATGKRSHLESSSRPH
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 31.1 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_035805
• Locus ID: 22245
• UniProt ID: P52623, A2AN37, Q3V218
• Cytogenetics: 2 B
• Refseq Size: 1966
• Refseq ORF: 834
• Synonyms: Umpk; URK1
• Summary: Phosphorylates uridine and cytidine to uridine monophosphate and cytidine monophosphate. Does not phosphorylate deoxyribonucleosides or purine ribonucleosides. Can use ATP or GTP as a phosphate donor. Can also phosphorylate cytidine and uridine nucleoside analogs such as 6-azauridine, 5-fluorouridine, 4-thiouridine, 5-bromouridine, N(4)-acetylcytidine, N(4)-benzoylcytidine, 5-fluorocytidine, 2-thiocytidine, 5-methylcytidine, and N(4)-anisoylcytidine (By similarity).[UniProtKB/Swiss-Prot Function]