C1ql3 (NM_153155) Mouse Recombinant Protein

CAT#: TP503279

Purified recombinant protein of Mouse C1q-like 3 (C1ql3), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR203279 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MVLLLVILIPVLVSSAGTSAHYEMLGTCRMVCDPYGGTKAPSTAATPDRGLMQSLPTFIQGPKGEAGRPG
  KAGPRGPPGEPGPPGPVGPPGEKGEPGRQGLPGPPGAPGLNAAGAISAATYSTVPKIAFYAGLKRQHEGY
  EVLKFDDVVTNLGNHYDPTTGKFTCSIPGIYFFTYHVLMRGGDGTSMWADLCKNNQVRASAIAQDADQNY
  DYASNSVVLHLEPGDEVYIKLDGGKAHGGNNNKYSTFSGFIIYAD
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 26.7 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_694795
• Locus ID: 227580
• UniProt ID: Q9ESN4, A0A3B0IT58
• Cytogenetics: 2 A1
• Refseq Size: 3163
• Refseq ORF: 768
• Synonyms: 1110065A22Rik; AI661623; C1ql; C1qtnf13; CTRP13; K100
• Summary: May regulate the number of excitatory synapses that are formed on hippocampus neurons. Has no effect on inhibitory synapses. Plays a role in glucose homeostasis. Via AMPK signaling pathway, stimulates glucose uptake in adipocytes, myotubes and hepatocytes and enhances insulin-stimulated glucose uptake. In a hepatoma cell line, reduces the expression of gluconeogenic enzymes G6PC and PCK1 and hence decreases de novo glucose production.[UniProtKB/Swiss-Prot Function]