Emg1 (NM_013536) Mouse Recombinant Protein

CAT#: TP503055

Purified recombinant protein of Mouse EMG1 N1-specific pseudouridine methyltransferase (Emg1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR203055 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSAASGGFQPRERRFSVQEQDWETTPPKKLRLGAGSKCGGRRLIVVLEGASLETVKVGKTYELLNCDRHK
  SMLLKNGRDPGEVRPDITHQSLLMLMDSPLNRAGLLQVYIHTQKNVLIEVNPQTRIPRTFDRFCGLMVQL
  LHKLSVRAADGPQKLLKVIKNPVSDHFPVGCMKIGTSFSVEDISDIRELVPSSDPVVFVVGAFAHGKVSV
  EYTEKMVSISNYPLSAALTCAKVTTAFEEVWGVI
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 27 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_038564
• Locus ID: 14791
• UniProt ID: O35130, Q542P8
• Cytogenetics: 6 59.17 cM
• Refseq Size: 1086
• Refseq ORF: 735
• Synonyms: C2f; Grcc2f
• Summary: S-adenosyl-L-methionine-dependent pseudouridine N(1)-methyltransferase that methylates pseudouridine at position 1248 (Psi1248) in 18S rRNA. Involved the biosynthesis of the hypermodified N1-methyl-N3-(3-amino-3-carboxypropyl) pseudouridine (m1acp3-Psi) conserved in eukaryotic 18S rRNA. Is not able to methylate uridine at this position. Has also an essential role in 40S ribosomal subunit biogenesis independent on its methyltransferase activity, facilitating the incorporation of ribosomal protein S19 during the formation of pre-ribosomes.[UniProtKB/Swiss-Prot Function]