Emg1 (NM_013536) Mouse Tagged ORF Clone

CAT#: MR203055

  • TrueORF®

Emg1 (Myc-DDK-tagged) - Mouse EMG1 nucleolar protein homolog (S. cerevisiae) (Emg1)

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK w/ Puro mGFP w/ Puro

AAV Particle: DDK


  "NM_013536" in other vectors (4)


Interest in protein/lysate? Submit request here!

Reconstitution Protocol

USD 300.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (4)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00

Other products for "Emg1"

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol Emg1
Synonyms C2f; Grcc2f
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR203055 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCTGCGGCCAGTGGTGGCTTCCAACCTCGTGAGCGGCGATTTTCAGTGCAGGAGCAGGACTGGGAGA
CTACGCCGCCTAAGAAGCTCCGGCTTGGGGCAGGAAGCAAGTGCGGAGGCCGGAGGCTCATTGTGGTGCT
GGAAGGGGCCAGTCTGGAGACAGTCAAGGTAGGGAAAACTTACGAGCTACTCAACTGTGACAGGCACAAG
TCCATGTTGTTGAAGAATGGACGGGACCCAGGGGAAGTCAGACCAGACATCACCCACCAGAGCCTGCTGA
TGCTTATGGACAGCCCCCTGAACCGAGCTGGCTTGCTACAGGTTTACATCCACACACAGAAGAACGTGCT
GATTGAAGTGAACCCCCAGACTCGAATTCCTAGAACCTTTGACCGATTTTGTGGCCTCATGGTTCAGCTT
TTACACAAACTGAGCGTCCGAGCAGCCGACGGCCCTCAGAAGCTATTGAAGGTAATTAAGAATCCAGTGT
CCGACCACTTCCCAGTTGGCTGTATGAAAATTGGCACTTCCTTTTCTGTTGAAGACATCAGTGACATTCG
AGAGTTGGTGCCCAGTAGTGACCCAGTTGTGTTTGTGGTGGGGGCCTTTGCCCATGGCAAGGTCAGTGTG
GAGTACACAGAAAAGATGGTGTCCATCAGCAACTATCCACTCTCTGCTGCGCTTACCTGTGCTAAAGTCA
CCACAGCTTTTGAAGAAGTATGGGGTGTCATT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR203055 protein sequence
Red=Cloning site Green=Tags(s)

MSAASGGFQPRERRFSVQEQDWETTPPKKLRLGAGSKCGGRRLIVVLEGASLETVKVGKTYELLNCDRHK
SMLLKNGRDPGEVRPDITHQSLLMLMDSPLNRAGLLQVYIHTQKNVLIEVNPQTRIPRTFDRFCGLMVQL
LHKLSVRAADGPQKLLKVIKNPVSDHFPVGCMKIGTSFSVEDISDIRELVPSSDPVVFVVGAFAHGKVSV
EYTEKMVSISNYPLSAALTCAKVTTAFEEVWGVI

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_013536
ORF Size 735 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_013536.2
RefSeq Size 1086 bp
RefSeq ORF 735 bp
Locus ID 14791
UniProt ID O35130
Cytogenetics 6 59.17 cM
MW 27 kDa
Gene Summary S-adenosyl-L-methionine-dependent pseudouridine N(1)-methyltransferase that methylates pseudouridine at position 1248 (Psi1248) in 18S rRNA. Involved the biosynthesis of the hypermodified N1-methyl-N3-(3-amino-3-carboxypropyl) pseudouridine (m1acp3-Psi) conserved in eukaryotic 18S rRNA. Is not able to methylate uridine at this position. Has also an essential role in 40S ribosomal subunit biogenesis independent on its methyltransferase activity, facilitating the incorporation of ribosomal protein S19 during the formation of pre-ribosomes.[UniProtKB/Swiss-Prot Function]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Order online and get additional $20 off!

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.