Ntpcr (NM_025636) Mouse Recombinant Protein

CAT#: TP501806

Purified recombinant protein of Mouse nucleoside-triphosphatase, cancer-related (Ntpcr), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug


USD 988.00

4 Weeks*

Size
    • 20 ug

Product Images

Frequently bought together (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

USD 471.00

Other products for "Ntpcr"

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR201806 protein sequence
Red=Cloning site Green=Tags(s)

MSRHVFLTGPPGVGKTTLIQKAIEVLQSSGLPVDGFYTQEVRQEGKRIGFDVVTLSGAQGPLSRVGSQPL
PGKPECRVGQYVVNLDSFEQLALPVLRNAGSSCGPKHRVCIIDEIGKMELFSQPFIQAVRQMLSTPGIIV
VGTIPVPKGKPLALVEEIRKRRDVKVFNVTRDNRNSLLPDIVAVVQSSRT

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 20.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_079912
Locus ID 66566
UniProt ID Q9CQA9
Cytogenetics 8 E2
Refseq Size 1155
Refseq ORF 573
Synonyms 2310079N02Rik; AI449709
Summary Has nucleotide phosphatase activity towards ATP, GTP, CTP, TTP and UTP. Hydrolyzes nucleoside diphosphates with lower efficiency (By similarity).[UniProtKB/Swiss-Prot Function]

Documents

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.