Flt3l (BC019801) Mouse Recombinant Protein

CAT#: TP501410

Purified recombinant protein of Mouse FMS-like tyrosine kinase 3 ligand (cDNA clone MGC:30232 IMAGE:5132319), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR201410 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTVLAPAWSPNSSLLLLLLLLSPCLRGTPDCYFSHSPISSNFKVKFRELTDHLLKDYPVTVAVNLQDEKH
  CKALWSLFLAQRWIEQLKTVAGSKMQTLLEDVNTEIHFVTSCTFQPLPECLRFVQTNISHLLKDTCTQLL
  ALKPCIGKACQNFSRCLETPPPCCPQGVP
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 19 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• Locus ID: 14256
• UniProt ID: P49772
• Cytogenetics: 7 29.14 cM
• Refseq Size: 990
• Refseq ORF: 507
• Synonyms: Flt3lg; Ly72L
• Summary: Stimulates the proliferation of early hematopoietic cells by activating FLT3. Synergizes well with a number of other colony stimulating factors and interleukins.[UniProtKB/Swiss-Prot Function]