Tsc22d3 (NM_010286) Mouse Recombinant Protein
CAT#: TP500843
Purified recombinant protein of Mouse TSC22 domain family, member 3 (Tsc22d3), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Product Images
![](https://cdn.origene.com/img/defaults-img.jpg)
Frequently bought together (1)
Other products for "Tsc22d3"
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR200843 protein sequence
Red=Cloning site Green=Tags(s) MNTEMYQTPMEVAVYQLHNFSISFFSSLLGGDVVSVKLDNSASGASVVALDNKIEQAMDLVKNHLMYAVR EEVEVLKEQIRELLEKNSQLERENTLLKTLASPEQLEKFQSRLSPEEPAPEAPETPETPEAPGGSAV myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 15.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_034416 |
Locus ID | 14605 |
UniProt ID | Q9Z2S7 |
Cytogenetics | X F1 |
Refseq Size | 1974 |
Refseq ORF | 414 |
Synonyms | DIP; Dsip1; Gilz; Tilz3; TSC-22R |
Summary | Protects T-cells from IL2 deprivation-induced apoptosis through the inhibition of FOXO3A transcriptional activity that leads to the down-regulation of the pro-apoptotic factor BCL2L11. In macrophages, plays a role in the anti-inflammatory and immunosuppressive effects of glucocorticoids and IL10. In T-cells, inhibits anti-CD3-induced NFKB1 nuclear translocation. In vitro, suppresses AP1 and NFKB1 DNA-binding activities (By similarity). Isoform 1 and isoform 4 inhibit myogenic differentiation and mediate anti-myogenic effects of glucocorticoids by binding and regulating MYOD1 and HDAC1 transcriptional activity resulting in reduced expression of MYOG.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.