CCDC85C (NM_001144995) Human Recombinant Protein

CAT#: TP327995

Purified recombinant protein of Homo sapiens coiled-coil domain containing 85C (CCDC85C), 20 µg

Product Images

Coomassie blue staining of purified CCDC85C protein (Cat# TP327995). The protein was produced from HEK293T cells transfected with CCDC85C cDNA clone (Cat# RC227995) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC227995 representing NM_001144995
  Red=Cloning site Green=Tags(s)
  
  MAKPAATAAAASEELSQVPDEELLRWSKEELARRLRRAEGEKVGLMLEHGGLMRDVNRRLQQHLLEIRGL
  KDVNQRLQDDNQELRELCCFLDDDRQKGRKLAREWQRFGRHAAGAVWHEVARSQQKLRELEARQEALLRE
  NLELKELVLLLDEERAALAATGAASGGGGGGGGAGSRSSIDSQASLSGPLSGGAPGAGARDVGDGSSTSS
  AGSGGSPDHHHHVPPPLLPPGPHKAPDGKAGATRRSLDDLSAPPHHRSIPNGLHDPSSTYIRQLESKVRL
  LEGDKLLAQQAGSGEFRTLRKGFSPYHSESQLASLPPSYQDSLQNGPACPAPELPSPPSAGYSPAGQKPE
  AVVHAMKVLEVHENLDRQLQDSCEEDLSEKEKAIVREMCNVVWRKLGDAASSKPSIRQHLSGNQFKGPL
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 45 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001138467
• Locus ID: 317762
• UniProt ID: A6NKD9
• Cytogenetics: 14q32.2
• Refseq ORF: 1257
• Summary: May play an important role in cortical development, especially in the maintenance of radial glia.[UniProtKB/Swiss-Prot Function]