Antibodies

View as table Download

CCDC85C (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 63-93 amino acids from the N-terminal region of human CC85C

CCDC85C rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human CCDC85C

CCDC85C rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human CCDC85C

Rabbit Polyclonal Anti-CCDC85C Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CCDC85C antibody is: synthetic peptide directed towards the C-terminal region of Human CCDC85C. Synthetic peptide located within the following region: HAMKVLEVHENLDRQLQDSCEEDLSEKEKAIVREMCNVVWRKLGDAASSK

Rabbit Polyclonal Anti-CCDC85C Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CCDC85C antibody is: synthetic peptide directed towards the N-terminal region of Human CCDC85C. Synthetic peptide located within the following region: HLLEIRGLKDVNQRLQDDNQELRELCCFLDDDRQKGRKLAREWQRFGRHA