RND2 (NM_005440) Human Recombinant Protein

CAT#: TP321840M

Recombinant protein of human Rho family GTPase 2 (RND2), 100 µg

Product Images

Coomassie blue staining of purified RND2 protein (Cat# TP321840). The protein was produced from HEK293T cells transfected with RND2 cDNA clone (Cat# RC221840) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC221840 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEGQSGRCKIVVVGDAECGKTALLQVFAKDAYPGSYVPTVFENYTASFEIDKRRIELNMWDTSGSSYYDN
  VRPLAYPDSDAVLICFDISRPETLDSVLKKWQGETQEFCPNAKVVLVGCKLDMRTDLATLRELSKQRLIP
  VTHEQGTVLAKQVGAVSYVECSSRSSERSVRDVFHVATVASLGRGHRQLRRTDSRRGMQRSAQLSGRPDR
  GNEGEIHKDRAKSCNLM
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 25.2 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_005431
• Locus ID: 8153
• UniProt ID: P52198
• Cytogenetics: 17q21.31
• Refseq Size: 4169
• Refseq ORF: 681
• Synonyms: ARHN; RHO7; RhoN
• Summary: This gene encodes a member of the Rho GTPase family, whose members play a key role in the regulation of actin cytoskeleton organization in response to extracellular growth factors. This particular family member has been implicated in the regulation of neuronal morphology and endosomal trafficking. The gene localizes to chromosome 17 and is the centromeric neighbor of the breast-ovarian cancer susceptibility gene BRCA1. [provided by RefSeq, Jul 2008]