PRSS42 (NM_182702) Human Recombinant Protein

CAT#: TP321595

Recombinant protein of human testis serine protease 2 (TESSP2), 20 µg

Product Images

Coomassie blue staining of purified PRSS42 protein (Cat# TP321595). The protein was produced from HEK293T cells transfected with PRSS42 cDNA clone (Cat# RC221595) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC221595 representing NM_182702
  Red=Cloning site Green=Tags(s)
  
  MSSGGGSRGLLAWLLLLQPWPGQNWAGMAAPRLPSPLLSEEGGENPEASPAPGPEAGPPLNLFTSFPGDS
  LLCGRTPLRIVGGVDAEEGRWPWQVSVRTKGRHICGGTLVTATWVLTAGHCISSRFHYSVKMGDRSVYNE
  NTSVVVSVQRAFVHPKFSTVTTIRNDLALLQLQHPVNFTSNIQPICIPQENFQVEGRTRCWVTGWGKTPE
  REKLASEILQDVDQYIMCYEECNKIIQKALSSTKDVIIKGMVCGYKEQGKDSCQGDSGGRLACEYNDTWV
  QVGIVSWGIGCGR
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 29.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_874361
• Locus ID: 339906
• UniProt ID: Q7Z5A4
• Cytogenetics: 3p21.31
• Refseq Size: 882
• Refseq ORF: 879
• Synonyms: TESSP2
• Summary: This gene encodes a member of a cluster of testis-specific serine proteases. The orthologous mouse gene is expressed during meiosis in pachytene spermatocytes and is required for germ cell survival. This human locus is represented as a pseudogene because it contains an early stop codon that disrupts the trypsin domain, compared to the mouse ortholog. [provided by RefSeq, Jan 2019]