MEIG1 (NM_001080836) Human Recombinant Protein
CAT#: TP319144
Recombinant protein of human meiosis expressed gene 1 homolog (mouse) (MEIG1), 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC219144 representing NM_001080836
Red=Cloning site Green=Tags(s) MASSDVKPKSVSHAKKWSEEIENLYRFQQAGYRDETEYRQVKQVSMVDRWPETGYVKKLQRRDNTFYYYN KQRECDDKEVHKVKIYAY myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 10.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001074305 |
Locus ID | 644890 |
UniProt ID | Q5JSS6 |
Cytogenetics | 10p13 |
Refseq Size | 507 |
Refseq ORF | 264 |
Synonyms | bA2K17.3; SPATA39 |
Summary | Essential for spermiogenesis.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC421121 | MEIG1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY421121 | Transient overexpression lysate of meiosis expressed gene 1 homolog (mouse) (MEIG1) |
USD 436.00 |
|
PH319144 | MEIG1 MS Standard C13 and N15-labeled recombinant protein (NP_001074305) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review