C1orf172 (KDF1) (NM_152365) Human Recombinant Protein

CAT#: TP318144L

Recombinant protein of human chromosome 1 open reading frame 172 (C1orf172), 1 mg

Product Images

Coomassie blue staining of purified KDF1 protein (Cat# TP318144). The protein was produced from HEK293T cells transfected with KDF1 cDNA clone (Cat# RC218144) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC218144 representing NM_152365
  Red=Cloning site Green=Tags(s)
  
  MPRPGHPRPASGPPRLGPWERPTELCLETYDKPPQPPPSRRTRRPDPKDPGHHGPESITFISGSAEPALE
  SPTCCLLWRPWVWEWCRAAFCFRRCRDCLQRCGACVRGCSPCLSTEDSTEGTAEANWAKEHNGVPPSPDR
  APPSRRDGQRLKSTMGSSFSYPDVKLKGIPVYPYPRATSPAPDADSCCKEPLADPPPMRHSLPSTFASSP
  RGSEEYYSFHESDLDLPEMGSGSMSSREIDVLIFKKLTELFSVHQIDELAKCTSDTVFLEKTSKISDLIS
  SITQDYHLDEQDAEGRLVRGIIRISTRKSRARPQTSEGRSTRAAAPTAAAPDSGHETMVGSGLSQDELTV
  QISQETTADAIARKLRPYGAPGYPASHDSSFQGTDTDSSGAPLLQVYC
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 43.5 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_689578
• Locus ID: 126695
• UniProt ID: Q8NAX2
• Cytogenetics: 1p36.11
• Refseq Size: 1785
• Refseq ORF: 1194
• Synonyms: C1orf172; ECTD12
• Summary: Plays a role in the regulation of the epidermis formation during early development. Required both as an inhibitor of basal cell proliferation and a promoter of differentiation of basal progenitor cell progeny (By similarity).[UniProtKB/Swiss-Prot Function]