ING1 (NM_198219) Human Recombinant Protein
CAT#: TP317763
Recombinant protein of human inhibitor of growth family, member 1 (ING1), transcript variant 1, 20 µg
View other "ING1" proteins (11)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC217763 protein sequence
Red=Cloning site Green=Tags(s) MLSPANGEQLHLVNYVEDYLDSIESLPFDLQRNVSLMREIDAKYQEILKELDECYERFSRETDGAQKRRM LHCVQRALIRSQELGDEKIQIVSQMVELVENRTRQVDSHVELFEAQQELGDTAGNSGKAGADRPKGEAAA QADKPNSKRSRRQRNNENRENASSNHDHDDGASGTPKEKKAKTSKKKKRSKAKAEREASPADLPIDPNEP TYCLCNQVSYGEMIGCDNDECPIEWFHFSCVGLNHKPKGKWYCPKCRGENEKTMDKALEKSKKERAYNR SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Predicted MW | 31.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_937862 |
Locus ID | 3621 |
UniProt ID | Q9UK53 |
Cytogenetics | 13q34 |
Refseq Size | 2887 |
Refseq ORF | 837 |
Synonyms | p24ING1c; p33; p33ING1; p33ING1b; p47; p47ING1a |
Summary | This gene encodes a tumor suppressor protein that can induce cell growth arrest and apoptosis. The encoded protein is a nuclear protein that physically interacts with the tumor suppressor protein TP53 and is a component of the p53 signaling pathway. Reduced expression and rearrangement of this gene have been detected in various cancers. Multiple alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403677 | ING1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC404951 | ING1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC417242 | ING1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LC429254 | ING1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC430724 | ING1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY403677 | Transient overexpression lysate of inhibitor of growth family, member 1 (ING1), transcript variant 2 |
USD 436.00 |
|
LY404951 | Transient overexpression lysate of inhibitor of growth family, member 1 (ING1), transcript variant 1 |
USD 436.00 |
|
LY417242 | Transient overexpression lysate of inhibitor of growth family, member 1 (ING1), transcript variant 4 |
USD 665.00 |
|
LY430724 | Transient overexpression lysate of inhibitor of growth family, member 1 (ING1), transcript variant 1 |
USD 436.00 |
|
PH317763 | ING1 MS Standard C13 and N15-labeled recombinant protein (NP_937862) |
USD 3,255.00 |
|
TP760507 | Purified recombinant protein of Human inhibitor of growth family, member 1 (ING1), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
USD 261.00 |
{0} Product Review(s)
Be the first one to submit a review