ELOF1 (NM_032377) Human Recombinant Protein
CAT#: TP317106
Recombinant protein of human elongation factor 1 homolog (S. cerevisiae) (ELOF1), 20 µg
View other "ELOF1" proteins (3)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC217106 representing NM_032377
Red=Cloning site Green=Tags(s) MGRRKSKRKPPPKKKMTGTLETQFTCPFCNHEKSCDVKMDRARNTGVISCTVCLEEFQTPITYLSEPVDV YSDWIDACEAANQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 9.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_115753 |
Locus ID | 84337 |
UniProt ID | P60002 |
Cytogenetics | 19p13.2 |
Refseq Size | 982 |
Refseq ORF | 249 |
Synonyms | ELF1 |
Summary | Transcription elongation factor implicated in the maintenance of proper chromatin structure in actively transcribed regions.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410170 | ELOF1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY410170 | Transient overexpression lysate of elongation factor 1 homolog (S. cerevisiae) (ELOF1) |
USD 436.00 |
|
PH317106 | ELOF1 MS Standard C13 and N15-labeled recombinant protein (NP_115753) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review