C5ORF33 (NADK2) (NM_001085411) Human Recombinant Protein
CAT#: TP314147
Recombinant protein of human chromosome 5 open reading frame 33 (C5orf33), transcript variant 1, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC214147 representing NM_001085411
Red=Cloning site Green=Tags(s) MTCYRGFLLGSCCRVAGGRAAALRGPGAGGPAARPRLGGDGGGRRHLGQGQPRELAGCGSRADGGFRPSR VVVVAKTTRYEFEQQRYRYAELSEEDLKQLLALKGSSYSGLLERHHIHTKNVEHIIDSLRNEGIEVRLVK RREYDEETVRWADAVIAAGGDGTMLLAASKVLDRLKPVIGVNTDPERSEGHLCLPVRYTHSFPEALQKFY RGEFRWLWRQRIRLYLEGTGINPVPVDLHEQQLSLNQHNRALNIERAHDERSEASGPQLLPVRALNEVFI GESLSSRASYYEISVDDGPWEKQKSSGLNLCTGTGSKAWSFNINRVATQAVEDVLNIAKRQGNLSLPLNR ELVEKVTNEYNESLLYSPEEPKILFSIREPIANRVFSSSRQRCFSSKVCVRSRCWDACMVVDGGTSFEFN DGAIASMMINKEDELRTVLLEQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 49.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001078880 |
Locus ID | 133686 |
UniProt ID | Q4G0N4 |
Cytogenetics | 5p13.2 |
Refseq Size | 3898 |
Refseq ORF | 1326 |
Synonyms | C5orf33; DECRD; MNADK; NADKD1 |
Summary | This gene encodes a mitochondrial kinase that catalyzes the phosphorylation of NAD to yield NADP. Mutations in this gene result in 2,4-dienoyl-CoA reductase deficiency. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2014] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407195 | NADK2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC421290 | NADK2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LY407195 | Transient overexpression lysate of chromosome 5 open reading frame 33 (C5orf33), transcript variant 2 |
USD 436.00 |
|
LY421290 | Transient overexpression lysate of chromosome 5 open reading frame 33 (C5orf33), transcript variant 1 |
USD 665.00 |
|
PH314147 | C5orf33 MS Standard C13 and N15-labeled recombinant protein (NP_001078880) |
USD 3,255.00 |
|
TP760230 | Recombinant protein of human chromosome 5 open reading frame 33 (C5orf33), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
USD 261.00 |
|
TP760315 | Recombinant protein of human chromosome 5 open reading frame 33 (C5orf33), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
USD 261.00 |
{0} Product Review(s)
Be the first one to submit a review