C5ORF33 (NADK2) (NM_001085411) Human Mass Spec Standard

CAT#: PH314147

C5orf33 MS Standard C13 and N15-labeled recombinant protein (NP_001078880)

Product Images

Coomassie blue staining of purified NADK2 protein (Cat# TP314147). The protein was produced from HEK293T cells transfected with NADK2 cDNA clone (Cat# RC214147) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC214147
• Predicted MW: 49.3 kDa
• Protein Sequence:
  Sequence Link

  >RC214147 representing NM_001085411
  Red=Cloning site Green=Tags(s)
  
  MTCYRGFLLGSCCRVAGGRAAALRGPGAGGPAARPRLGGDGGGRRHLGQGQPRELAGCGSRADGGFRPSR
  VVVVAKTTRYEFEQQRYRYAELSEEDLKQLLALKGSSYSGLLERHHIHTKNVEHIIDSLRNEGIEVRLVK
  RREYDEETVRWADAVIAAGGDGTMLLAASKVLDRLKPVIGVNTDPERSEGHLCLPVRYTHSFPEALQKFY
  RGEFRWLWRQRIRLYLEGTGINPVPVDLHEQQLSLNQHNRALNIERAHDERSEASGPQLLPVRALNEVFI
  GESLSSRASYYEISVDDGPWEKQKSSGLNLCTGTGSKAWSFNINRVATQAVEDVLNIAKRQGNLSLPLNR
  ELVEKVTNEYNESLLYSPEEPKILFSIREPIANRVFSSSRQRCFSSKVCVRSRCWDACMVVDGGTSFEFN
  DGAIASMMINKEDELRTVLLEQ
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001078880
• RefSeq Size: 3898
• RefSeq ORF: 1326
• Synonyms: C5orf33; DECRD; MNADK; NADKD1
• Locus ID: 133686
• UniProt ID: Q4G0N4
• Cytogenetics: 5p13.2
• Summary: This gene encodes a mitochondrial kinase that catalyzes the phosphorylation of NAD to yield NADP. Mutations in this gene result in 2,4-dienoyl-CoA reductase deficiency. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2014]