Nebulette (NEBL) (NM_213569) Human Recombinant Protein
CAT#: TP312733
Recombinant protein of human nebulette (NEBL), transcript variant 2, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC212733 representing NM_213569
Red=Cloning site Green=Tags(s) MNPQCARCGKVVYPTEKVNCLDKYWHKGCFHCEVCKMALNMNNYKGYEKKPYCNAHYPKQSFTTVADTPE NLRLKQQSELQSQVKYKRDFEESKGRGFSIVTDTPELQRLKRTQEQISNVKYHEDFEKTKGRGFTPVVDD PVTERVRKNTQVVSDAAYKGVHPHIVEMDRRPGIIVAPVLPGAYQQSHSQGYGYMHQTSVSSMRSMQHSP NLRTYRAMYDYSAQDEDEVSFRDGDYIVNVQPIDDGWMYGTVQRTGRTGMLPANYIEFVN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 31 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_998734 |
Locus ID | 10529 |
UniProt ID | O76041, Q59FZ8 |
Cytogenetics | 10p12.31 |
Refseq Size | 1245 |
Refseq ORF | 810 |
Synonyms | bA165O3.1; C10orf113; LASP2; LNEBL |
Summary | This gene encodes a nebulin like protein that is abundantly expressed in cardiac muscle. The encoded protein binds actin and interacts with thin filaments and Z-line associated proteins in striated muscle. This protein may be involved in cardiac myofibril assembly. A shorter isoform of this protein termed LIM nebulette is expressed in non-muscle cells and may function as a component of focal adhesion complexes. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Mar 2010] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403905 | NEBL HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY403905 | Transient overexpression lysate of nebulette (NEBL), transcript variant 2 |
USD 436.00 |
|
PH312733 | NEBL MS Standard C13 and N15-labeled recombinant protein (NP_998734) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review