Nebulette (NEBL) (NM_213569) Human Mass Spec Standard

CAT#: PH312733

NEBL MS Standard C13 and N15-labeled recombinant protein (NP_998734)

Product Images

Coomassie blue staining of purified NEBL protein (Cat# TP312733). The protein was produced from HEK293T cells transfected with NEBL cDNA clone (Cat# RC212733) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC212733
• Predicted MW: 31 kDa
• Protein Sequence:
  Sequence Link

  >RC212733 representing NM_213569
  Red=Cloning site Green=Tags(s)
  
  MNPQCARCGKVVYPTEKVNCLDKYWHKGCFHCEVCKMALNMNNYKGYEKKPYCNAHYPKQSFTTVADTPE
  NLRLKQQSELQSQVKYKRDFEESKGRGFSIVTDTPELQRLKRTQEQISNVKYHEDFEKTKGRGFTPVVDD
  PVTERVRKNTQVVSDAAYKGVHPHIVEMDRRPGIIVAPVLPGAYQQSHSQGYGYMHQTSVSSMRSMQHSP
  NLRTYRAMYDYSAQDEDEVSFRDGDYIVNVQPIDDGWMYGTVQRTGRTGMLPANYIEFVN
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_998734
• RefSeq Size: 1245
• RefSeq ORF: 810
• Synonyms: bA165O3.1; C10orf113; LASP2; LNEBL
• Locus ID: 10529
• UniProt ID: O76041, Q59FZ8
• Cytogenetics: 10p12.31
• Summary: This gene encodes a nebulin like protein that is abundantly expressed in cardiac muscle. The encoded protein binds actin and interacts with thin filaments and Z-line associated proteins in striated muscle. This protein may be involved in cardiac myofibril assembly. A shorter isoform of this protein termed LIM nebulette is expressed in non-muscle cells and may function as a component of focal adhesion complexes. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Mar 2010]